- Recombinant Haemophilus influenzae Uncharacterized protein HI_0974.1 (HI_0974.1)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1182652
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 9,818 Da
- E Coli or Yeast
- 31048
- Uncharacterized protein HI_0974.1 (HI_0974.1)
Sequence
MTLKQRYQQAGKEASWALSLSILYVIGWCLCAYLPKETQGPIGFPLWFELSCIYLPILFIVIGHWIIKIIFQDISLEINDQGNQK